Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFS2 Peptide - N-terminal region

NDUFS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CI-49kD

UniProt

A0A0A6YW30

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001159631.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MVPVRGARQWQPDIEWAEQFSGAVMYPSKETAHWKPPPWNDVDILKEKAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETD2 Mouse Monoclonal Antibody [Clone ID: OTI3G8]
CF804268 100 µg

SETD2 Mouse Monoclonal Antibody [Clone ID: OTI3G8]

Sign In for Pricing
View Details
PGP9.5 Recombinant Rabbit Monoclonal Antibody [JF93-08]
ET1702-83 100 µL

PGP9.5 Recombinant Rabbit Monoclonal Antibody [JF93-08]

Sign In for Pricing
View Details
HSD11B1L Human Gene Knockout Kit (CRISPR)
KN421286 1 Kit

HSD11B1L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ticagrelor
TRC-T437700-50MG 50 mg

Ticagrelor

Sign In for Pricing
View Details
2-Azidoethyl 2-Acetamido-2-deoxy-b-D-glucopyranoside
TRC-A848995-50MG 50 mg

2-Azidoethyl 2-Acetamido-2-deoxy-b-D-glucopyranoside

Sign In for Pricing
View Details
FAAH1 (FAAH) (NM_001441) Human Recombinant Protein
TP310331M 100 µg

FAAH1 (FAAH) (NM_001441) Human Recombinant Protein

Sign In for Pricing
View Details