Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRFN4 Peptide - C-terminal region

LRFN4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SALM3, SALM3., FIGLER6

UniProt

Q6PJG9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRFN4 Rabbit Polyclonal Antibody (orb589130) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076941.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HVQSQTNGGPSPTPKAHPPRSPPPRPQRSCSLDLGDAGCYGYARRLGGAW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKAP3 Protein Lysate (Rat) with C-HA Tag
11653036 100 µg

AKAP3 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Rabbit Polyclonal Use1/UBE2Z Antibody [DyLight 350]
NBP2-97553UV 0.1 mL

Rabbit Polyclonal Use1/UBE2Z Antibody [DyLight 350]

Sign In for Pricing
View Details
KAT7 (Histone Acetyltransferase KAT7, Histone Acetyltransferase Binding to ORC1, Lysine Acetyltransferase 7, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 2, MYST-2, HBO1, HBOa, MYST2) APC
MBS6386414-01 0.1 mL

KAT7 (Histone Acetyltransferase KAT7, Histone Acetyltransferase Binding to ORC1, Lysine Acetyltransferase 7, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 2, MYST-2, HBO1, HBOa, MYST2) APC

Sign In for Pricing
View Details
KAT7 (Histone Acetyltransferase KAT7, Histone Acetyltransferase Binding to ORC1, Lysine Acetyltransferase 7, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 2, MYST-2, HBO1, HBOa, MYST2) APC
MBS6386414-02 5x 0.1 mL

KAT7 (Histone Acetyltransferase KAT7, Histone Acetyltransferase Binding to ORC1, Lysine Acetyltransferase 7, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 2, MYST-2, HBO1, HBOa, MYST2) APC

Sign In for Pricing
View Details
PTK6 (Protein-Tyrosine Kinase 6)
489727 100 µL

PTK6 (Protein-Tyrosine Kinase 6)

Sign In for Pricing
View Details
CD86 polyclonal antibody
NCP0233P-01 50 µL

CD86 polyclonal antibody

Sign In for Pricing
View Details