Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20ORF85 Peptide - middle region

C20ORF85 Peptide - middle region

Product Specifications

Product Name Alternative

LLC1, bA196N14.1

UniProt

Q9H1P6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C20ORF85 Rabbit Polyclonal Antibody (orb55695) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848551

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIKCEEDLPTPKPKIELPERFRIRPVTPVEKYIKVFPSPPVPQTTQGFIG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fbx15 (FBXO15) Human qPCR Primer Pair (NM_001142958)
HP233600 200 Reactions

Fbx15 (FBXO15) Human qPCR Primer Pair (NM_001142958)

Sign In for Pricing
View Details
PEMT CRISPR/Cas9 KO Plasmid (m)
sc-422189 20 µg

PEMT CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Evacetrapib (LY2484595)
C17150-10mM/1mL 10 mM/1mL

Evacetrapib (LY2484595)

Sign In for Pricing
View Details
IKK alpha/beta peptide
orb339305-01 1 mg

IKK alpha/beta peptide

Sign In for Pricing
View Details
IKK alpha/beta peptide
orb339305-02 5 mg

IKK alpha/beta peptide

Sign In for Pricing
View Details
CRYAA CRISPRa sgRNA lentivector (set of three targets)(Mouse)
16873124 3x 1.0µg DNA

CRYAA CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details