Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20ORF85 Peptide - middle region

C20ORF85 Peptide - middle region

Product Specifications

Product Name Alternative

LLC1, bA196N14.1

UniProt

Q9H1P6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C20ORF85 Rabbit Polyclonal Antibody (orb55695) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848551

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIKCEEDLPTPKPKIELPERFRIRPVTPVEKYIKVFPSPPVPQTTQGFIG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human UBD Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (IHC,ELISA) 200ul
IRBAHUUBDAAP910200UL 200 µL

Rabbit Anti Human UBD Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (IHC,ELISA) 200ul

Sign In for Pricing
View Details
Rtcb Rat Pre-designed siRNA Set A
HY-RS27328 1 Set

Rtcb Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse ESM1 ELISA Kit
orb408042-01 24 Tests

Mouse ESM1 ELISA Kit

Sign In for Pricing
View Details
Mouse ESM1 ELISA Kit
orb408042-02 48 Tests

Mouse ESM1 ELISA Kit

Sign In for Pricing
View Details
Mouse ESM1 ELISA Kit
orb408042-03 96 Tests

Mouse ESM1 ELISA Kit

Sign In for Pricing
View Details
Mouse ESM1 ELISA Kit
orb408042-04 5 x 96 T

Mouse ESM1 ELISA Kit

Sign In for Pricing
View Details