Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLG Peptide - N-terminal region

PLG Peptide - N-terminal region

Product Specifications

UniProt

P00747

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLG Rabbit Polyclonal Antibody (orb588658) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000292.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGF2BP1 Rabbit Polyclonal Antibody
TA377375 100 µL

IGF2BP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Stigmasteryl Ferulate
TRC-S686768-10MG 10 mg

Stigmasteryl Ferulate

Sign In for Pricing
View Details
GRTP1 Human Gene Knockout Kit (CRISPR)
KN424756 1 Kit

GRTP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SOX9 Rabbit Polyclonal Antibody
TA371249 100 µL

SOX9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PIK3CB Antibody
KC-24932-01 50 μL

PIK3CB Antibody

Sign In for Pricing
View Details
PIK3CB Antibody
KC-24932-02 100 µL

PIK3CB Antibody

Sign In for Pricing
View Details