PLG Peptide - N-terminal region
PLG Peptide - N-terminal region
Product Specifications
UniProt
P00747
Field of Research
Cardiovascular Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLG Rabbit Polyclonal Antibody (orb588658) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000292.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSST
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP303746M 100 µg
U1SNRNPBP (SNRNP35) (NM_180699) Human Recombinant Protein
Sign In for Pricing
View Details 
![NEFM Recombinant Rabbit Monoclonal Antibody [JM11-20]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea8262a/imageurl/et1703-57.webp)
ET1703-57 100 µL
NEFM Recombinant Rabbit Monoclonal Antibody [JM11-20]
Sign In for Pricing
View Details 
![PerCP/Cyanine5.5 Anti-Human TCR Vα24-Jα18 Antibody[6B11]](https://cdn.genprice.uk/products/763/68dd14af061270361e7d3a03/imageurl08/an00568j.webp)
AN00568J-01 20 Tests
PerCP/Cyanine5.5 Anti-Human TCR Vα24-Jα18 Antibody[6B11]
Sign In for Pricing
View Details AN00568J-02 100 Tests
PerCP/Cyanine5.5 Anti-Human TCR Vα24-Jα18 Antibody[6B11]
Sign In for Pricing
View Details