MRAS Peptide - C-terminal region
MRAS Peptide - C-terminal region
Product Specifications
Product Name Alternative
AI326250, 2900078C09Rik
UniProt
O08989
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MRAS Rabbit Polyclonal Antibody (orb588786) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032650.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PYIETSAKDPPLNVDKTFHDLVRVIRQQVPEKNQKKKKKTKWRGDRATGT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2998930-01 48 Tests
Mouse PPARa (Peroxisome Proliferator Activated Receptor Alpha) Microsample ELISA Kit
Sign In for Pricing
View Details orb2998930-02 96 Tests
Mouse PPARa (Peroxisome Proliferator Activated Receptor Alpha) Microsample ELISA Kit
Sign In for Pricing
View Details 
NBP1-00153 0.1 mg
Goat Polyclonal Argininosuccinate Synthase Antibody
Sign In for Pricing
View Details 
RK14817 96 Tests
Rat Regulator of G-protein signaling 9 (RGS9) ELISA Kit
Sign In for Pricing
View Details