Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRAS Peptide - C-terminal region

MRAS Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI326250, 2900078C09Rik

UniProt

O08989

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRAS Rabbit Polyclonal Antibody (orb588786) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032650.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PYIETSAKDPPLNVDKTFHDLVRVIRQQVPEKNQKKKKKTKWRGDRATGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS23 siRNA (Rat)
orb1830771-01 15 nmol

RPS23 siRNA (Rat)

Sign In for Pricing
View Details
RPS23 siRNA (Rat)
orb1830771-02 30 nmol

RPS23 siRNA (Rat)

Sign In for Pricing
View Details
CD1D Protein Lysate
OCOA00598-20UG 20 µg

CD1D Protein Lysate

Sign In for Pricing
View Details
LentimiRa-mmu-miR-20b-3p Vector
mm41231 500 ng

LentimiRa-mmu-miR-20b-3p Vector

Sign In for Pricing
View Details
PARP1 AAV Vector (Rat) (CMV)
36022106 1 µg

PARP1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus recX Protein (aa 1-272) (strain Newman)
VAng-Cr6123-1mgEcoli 1 mg (E. coli)

Recombinant Staphylococcus Aureus recX Protein (aa 1-272) (strain Newman)

Sign In for Pricing
View Details