Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDCD2 Peptide - middle region

PDCD2 Peptide - middle region

Product Specifications

Product Name Alternative

RP8, ZMYND7

UniProt

Q16342

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDCD2 Rabbit Polyclonal Antibody (orb588323) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001186391.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFYSYEPPSENPPPETGESVCLQLKSGAHLCRVCGCLGPKTCSRCHKAYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2,3-Tris (diethylamino) cyclopropenylium dicyanamide
GW2679-1g 1 g

1,2,3-Tris (diethylamino) cyclopropenylium dicyanamide

Sign In for Pricing
View Details
Rabbit Guanine nucleotide-binding protein G (I) /G (S) /G (T) subunit beta-3 ELISA kit
GTR10384041 96 Well

Rabbit Guanine nucleotide-binding protein G (I) /G (S) /G (T) subunit beta-3 ELISA kit

Sign In for Pricing
View Details
Pcdha4 (BC060211) Mouse Recombinant Protein
PM45401M5 20 µg

Pcdha4 (BC060211) Mouse Recombinant Protein

Sign In for Pricing
View Details
OR6D1P Adenovirus (Human)
35508051 1.0 mL

OR6D1P Adenovirus (Human)

Sign In for Pricing
View Details
Miptenalimab (Anti-LAG3 / CD223)
A2997-1mg 1 mg

Miptenalimab (Anti-LAG3 / CD223)

Sign In for Pricing
View Details
Surfactant Protein C (SP-C) Magnetic Fluorescence Assay Kit
MBS2157598-01 96 Tests

Surfactant Protein C (SP-C) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details