Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDCD2 Peptide - middle region

PDCD2 Peptide - middle region

Product Specifications

Product Name Alternative

RP8, ZMYND7

UniProt

Q16342

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDCD2 Rabbit Polyclonal Antibody (orb588323) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001186391.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFYSYEPPSENPPPETGESVCLQLKSGAHLCRVCGCLGPKTCSRCHKAYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FoxO1 (phospho Ser319) Polyclonal Antibody
E44H00558 100 µL

FoxO1 (phospho Ser319) Polyclonal Antibody

Sign In for Pricing
View Details
Olr1539 (NM_001000729) Rat Tagged Lenti ORF Clone
RR203507L3 10 µg

Olr1539 (NM_001000729) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
p15 INK4b (CDKN2B) Mouse Monoclonal Antibody [Clone ID: OTI8H4]
TA505208S 30 µL

p15 INK4b (CDKN2B) Mouse Monoclonal Antibody [Clone ID: OTI8H4]

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Caveolin 1 (CAV1)
MBS2039543-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Caveolin 1 (CAV1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Caveolin 1 (CAV1)
MBS2039543-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Caveolin 1 (CAV1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Caveolin 1 (CAV1)
MBS2039543-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Caveolin 1 (CAV1)

Sign In for Pricing
View Details