Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R5A Peptide - middle region

PPP2R5A Peptide - middle region

Product Specifications

Product Name Alternative

B56A, PR61A

UniProt

Q15172

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP2R5A Rabbit Polyclonal Antibody (orb588663) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001186685.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf93 (FAM213B) (NM_152371) Human Over-expression Lysate
LS127281-20ug 20 µg

C1orf93 (FAM213B) (NM_152371) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Acvr1b/Activin receptor type-1B ELISA Kit
MBS2905146-01 48 Well

Rat Acvr1b/Activin receptor type-1B ELISA Kit

Sign In for Pricing
View Details
Rat Acvr1b/Activin receptor type-1B ELISA Kit
MBS2905146-02 96 Well

Rat Acvr1b/Activin receptor type-1B ELISA Kit

Sign In for Pricing
View Details
Rat Acvr1b/Activin receptor type-1B ELISA Kit
MBS2905146-03 5x 96 Well

Rat Acvr1b/Activin receptor type-1B ELISA Kit

Sign In for Pricing
View Details
Rat Acvr1b/Activin receptor type-1B ELISA Kit
MBS2905146-04 10x 96 Well

Rat Acvr1b/Activin receptor type-1B ELISA Kit

Sign In for Pricing
View Details
RPS18
MBS200949-01 0.01 mg

RPS18

Sign In for Pricing
View Details