PPP2R5A Peptide - middle region
PPP2R5A Peptide - middle region
Product Specifications
Product Name Alternative
B56A, PR61A
UniProt
Q15172
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP2R5A Rabbit Polyclonal Antibody (orb588663) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001186685.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4120604 1.0 µg DNA
Zdhhc7 sgRNA CRISPR Lentivector (Mouse) (Target 3)
Sign In for Pricing
View Details 
30478141 1x 10^6 Cells / 1.0 mL
MRPL37 CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details