Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNT7 Peptide - N-terminal region

GALNT7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GalNAcT7, GALNAC-T7

UniProt

Q86SF2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALNT7 Rabbit Polyclonal Antibody (orb588836) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059119.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLVVGSFLGLVVLWSSLTPRPDDPSPLSRMREDRDVNDPMPNRGGNGLAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COQ3 Rabbit Polyclonal Antibody
AP17950PU-N 400 µL

COQ3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Alternamine B Hydrochloride
TRC-A206480-1MG 1 mg

Alternamine B Hydrochloride

Sign In for Pricing
View Details
LRRC38 (NM_001010847) Human Over-expression Lysate
LY434137 100 µg

LRRC38 (NM_001010847) Human Over-expression Lysate

Sign In for Pricing
View Details
CD137 Mouse Monoclonal Antibody [2G1]
M1701-11 100 µL

CD137 Mouse Monoclonal Antibody [2G1]

Sign In for Pricing
View Details
SH3RF3 (NM_001099289) Human Over-expression Lysate
LY420427 100 µg

SH3RF3 (NM_001099289) Human Over-expression Lysate

Sign In for Pricing
View Details
MS4A8B (MS4A8) (NM_031457) Human Over-expression Lysate
LY403116 100 µg

MS4A8B (MS4A8) (NM_031457) Human Over-expression Lysate

Sign In for Pricing
View Details