NPRL3 Peptide - N-terminal region
NPRL3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MARE, NPR3, HS-40, RMD11, CGTHBA, C16orf35
UniProt
Q12980
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NPRL3 Rabbit Polyclonal Antibody (orb588983) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001070818.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NKLLFRYPFQRSQEHPASQTSKPRSRYAASNTGDHADEQDGDSRFSDVIL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1063-500 1x 500 µL
VEGF-A (VEGF/1063), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
