Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPRL3 Peptide - N-terminal region

NPRL3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MARE, NPR3, HS-40, RMD11, CGTHBA, C16orf35

UniProt

Q12980

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPRL3 Rabbit Polyclonal Antibody (orb588983) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001070818.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NKLLFRYPFQRSQEHPASQTSKPRSRYAASNTGDHADEQDGDSRFSDVIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N5-(3-Aminopropyl)-ornithine Dihydrochloride
TRC-A333580-100MG 100 mg

N5-(3-Aminopropyl)-ornithine Dihydrochloride

Sign In for Pricing
View Details
WNT3 (NM_030753) Human Over-expression Lysate
LY403082 100 µg

WNT3 (NM_030753) Human Over-expression Lysate

Sign In for Pricing
View Details
Hydrotalcite, synthetic
TRC-H714835-50G 50 g

Hydrotalcite, synthetic

Sign In for Pricing
View Details
2,2-Dioxo-1,2-benzoxanthin-4(3h)-one-D₄
TRC-D976391-10MG 10 mg

2,2-Dioxo-1,2-benzoxanthin-4(3h)-one-D₄

Sign In for Pricing
View Details
Plazomicin Sulfate (>85%)
TRC-P579505-2.5MG 2.5 mg

Plazomicin Sulfate (>85%)

Sign In for Pricing
View Details
Human MRPS23 activation kit by CRISPRa
GA109921 1 Kit

Human MRPS23 activation kit by CRISPRa

Sign In for Pricing
View Details