Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYG1 Peptide - middle region

GYG1 Peptide - middle region

Product Specifications

Product Name Alternative

GYG, GSD15

UniProt

P46976

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GYG1 Rabbit Polyclonal Antibody (orb589170) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171649.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Skin
CR562983 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
Human Hemoglobin Gamma 2 (HBg2) ELISA Kit
RD-HBg2-Hu-01 96 Tests

Human Hemoglobin Gamma 2 (HBg2) ELISA Kit

Sign In for Pricing
View Details
Human Hemoglobin Gamma 2 (HBg2) ELISA Kit
RD-HBg2-Hu-02 48 Tests

Human Hemoglobin Gamma 2 (HBg2) ELISA Kit

Sign In for Pricing
View Details
CELF4 Antibody
KC-43413-01 50 μL

CELF4 Antibody

Sign In for Pricing
View Details
CELF4 Antibody
KC-43413-02 100 µL

CELF4 Antibody

Sign In for Pricing
View Details
CELF4 Antibody
KC-43413-03 1 mL

CELF4 Antibody

Sign In for Pricing
View Details