Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYG1 Peptide - middle region

GYG1 Peptide - middle region

Product Specifications

Product Name Alternative

GYG, GSD15

UniProt

P46976

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GYG1 Rabbit Polyclonal Antibody (orb589170) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171649.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnase11 Mouse Gene Knockout Kit (CRISPR)
KN514866 1 Kit

Rnase11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bcl-x (BX006 + 2H12), CF568 conjugate, 0.1mg/mL
BNC680752-100 1x 100 µL

Bcl-x (BX006 + 2H12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Ethynylpyridine Hydrochloride (>85%)
TRC-B124843-50MG 50 mg

4-Ethynylpyridine Hydrochloride (>85%)

Sign In for Pricing
View Details
Tissue Total RNA, Soft tissue
CR559284 5 µg

Tissue Total RNA, Soft tissue

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2479), CF568 conjugate, 0.1mg/mL
BNC682479-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/2479), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ITM2C (NM_001012516) Human Over-expression Lysate
LC422882 20 µg

ITM2C (NM_001012516) Human Over-expression Lysate

Sign In for Pricing
View Details