Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5PD Peptide - C-terminal region

ATP5PD Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATPQ, ATP5H

UniProt

O75947

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP5PD Rabbit Polyclonal Antibody (orb581596) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006347

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TBC1D15 Antibody [CoraFluor 1]
NBP2-36553CL1 0.1 mL

Rabbit Polyclonal TBC1D15 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
RRAS Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2392182 100 µL

RRAS Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Emilin2 3'UTR GFP Stable Cell Line
TU155794 1.0 mL

Emilin2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni rplX Protein (aa 1-77) (strain 81116 / NCTC 11828)
VAng-Ly2357-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Jejuni rplX Protein (aa 1-77) (strain 81116 / NCTC 11828)

Sign In for Pricing
View Details
SERINC3 Antibody
A73350-100UL 100 µL

SERINC3 Antibody

Sign In for Pricing
View Details
ACSBG1 Human Gene Knockout Kit (CRISPR)
KN403219 1 Kit

ACSBG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details