Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5PD Peptide - C-terminal region

ATP5PD Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATPQ, ATP5H

UniProt

O75947

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP5PD Rabbit Polyclonal Antibody (orb581596) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006347

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Tetani murA2 Protein (aa 1-417)
VAng-Lsx01692-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Tetani murA2 Protein (aa 1-417)

Sign In for Pricing
View Details
HRP-Goat Anti-Guinea Pig IgG (H+L)
FNSA-0012-01 100 µL

HRP-Goat Anti-Guinea Pig IgG (H+L)

Sign In for Pricing
View Details
HRP-Goat Anti-Guinea Pig IgG (H+L)
FNSA-0012-02 500 µL

HRP-Goat Anti-Guinea Pig IgG (H+L)

Sign In for Pricing
View Details
Mouse ENPP2 (Ectonucleotide Pyrophosphatase/Phosphodiesterase 2) ELISA Kit
MBS8806468-01 48 Well

Mouse ENPP2 (Ectonucleotide Pyrophosphatase/Phosphodiesterase 2) ELISA Kit

Sign In for Pricing
View Details
Mouse ENPP2 (Ectonucleotide Pyrophosphatase/Phosphodiesterase 2) ELISA Kit
MBS8806468-02 96 Well

Mouse ENPP2 (Ectonucleotide Pyrophosphatase/Phosphodiesterase 2) ELISA Kit

Sign In for Pricing
View Details
Mouse ENPP2 (Ectonucleotide Pyrophosphatase/Phosphodiesterase 2) ELISA Kit
MBS8806468-03 5x 96 Well

Mouse ENPP2 (Ectonucleotide Pyrophosphatase/Phosphodiesterase 2) ELISA Kit

Sign In for Pricing
View Details