IBA57 Peptide - middle region
IBA57 Peptide - middle region
Product Specifications
Product Name Alternative
MMDS3, SPG74, C1orf69
UniProt
Q5T440
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IBA57 Rabbit Polyclonal Antibody (orb589175) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001010867.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPEACGAASLQERAGAAAILIRDPRTARMGWRLLTQDEGPALVPGGRLGD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042745-500 1x 500 µL
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880762-100 1x 100 µL
IgM Immunoglobulin (Cocktail), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
