Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGAL Peptide - middle region

ITGAL Peptide - middle region

Product Specifications

Product Name Alternative

CD11A, LFA-1, LFA1A

UniProt

P20701

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITGAL Rabbit Polyclonal Antibody (orb589199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001107852.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSCTDFSFHFPVCVQDLISPINVSLNFSLWEEEGTPRDQRAQGKDIPPIL

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYK2 (phospho Tyr580) Polyclonal Antibody
13593-01 50 µL

PYK2 (phospho Tyr580) Polyclonal Antibody

Sign In for Pricing
View Details
PYK2 (phospho Tyr580) Polyclonal Antibody
13593-02 100 µL

PYK2 (phospho Tyr580) Polyclonal Antibody

Sign In for Pricing
View Details
NXNL1 (TXNL6, Nucleoredoxin-like Protein 1, Thioredoxin-like Protein 6, RDCVF) (AP)
MBS6134398-01 0.1 mL

NXNL1 (TXNL6, Nucleoredoxin-like Protein 1, Thioredoxin-like Protein 6, RDCVF) (AP)

Sign In for Pricing
View Details
NXNL1 (TXNL6, Nucleoredoxin-like Protein 1, Thioredoxin-like Protein 6, RDCVF) (AP)
MBS6134398-02 5x 0.1 mL

NXNL1 (TXNL6, Nucleoredoxin-like Protein 1, Thioredoxin-like Protein 6, RDCVF) (AP)

Sign In for Pricing
View Details
Recombinant Pseudomonas mendocina Homoserine O-acetyltransferase (metX)
MBS1248621-01 0.02 mg (E-Coli)

Recombinant Pseudomonas mendocina Homoserine O-acetyltransferase (metX)

Sign In for Pricing
View Details
Recombinant Pseudomonas mendocina Homoserine O-acetyltransferase (metX)
MBS1248621-02 0.02 mg (Yeast)

Recombinant Pseudomonas mendocina Homoserine O-acetyltransferase (metX)

Sign In for Pricing
View Details