Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGAL Peptide - middle region

ITGAL Peptide - middle region

Product Specifications

Product Name Alternative

CD11A, LFA-1, LFA1A

UniProt

P20701

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITGAL Rabbit Polyclonal Antibody (orb589199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001107852.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSCTDFSFHFPVCVQDLISPINVSLNFSLWEEEGTPRDQRAQGKDIPPIL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TMEM184A Antibody [CoraFluor 1]
NBP1-77142CL1 0.1 mL

Rabbit Polyclonal TMEM184A Antibody [CoraFluor 1]

Sign In for Pricing
View Details
1-Bromocyclohept-1-ene
TAA31764 2.5 g

1-Bromocyclohept-1-ene

Sign In for Pricing
View Details
Rabbit Polyclonal RAPGEF3 Antibody
NBP1-57044 100 µL

Rabbit Polyclonal RAPGEF3 Antibody

Sign In for Pricing
View Details
Olfr78 ORF Vector (Mouse) (pORF)
33436015 1.0 µg DNA

Olfr78 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal HEATR4 Antibody
NBP3-05832-100ul 100 µL

Rabbit Polyclonal HEATR4 Antibody

Sign In for Pricing
View Details
CD1A Monoclonal Antibody
MBS9524758-01 0.05 mL

CD1A Monoclonal Antibody

Sign In for Pricing
View Details