PSMC3 Peptide - middle region
PSMC3 Peptide - middle region
Product Specifications
Product Name Alternative
TBP1
UniProt
P17980
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PSMC3 Rabbit Polyclonal Antibody (orb588340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002795.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ADAD1-304M 50 µg
Recombinant Mouse ADAD1 Protein, His (Fc)-Avi-tagged
Sign In for Pricing
View Details 
K3532807 1.0 µg DNA
Atp6v0a4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 
C2254-56-ML490 100 µL
CD3 (Early T Cell Marker, T Cell receptor Complex, TCR) (MaxLight 490) discontinued
Sign In for Pricing
View Details MBS6004415-01 0.2 mL
Dyrk4, CT (Dyrk4, Dual specificity tyrosine-phosphorylation-regulated kinase 4)
Sign In for Pricing
View Details