TK2 Peptide - N-terminal region
TK2 Peptide - N-terminal region
Product Specifications
UniProt
O00142
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TK2 Rabbit Polyclonal Antibody (orb588376) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001166114.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RALRCFGPGSRGSPASGPGPRRVQRRAWPPDKEQEKEKKSVICVEGNIAS
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2658950-01 20 µg
Recombinant Caenorhabditis elegans SAM domain-containing protein (bcc-1), partial
Sign In for Pricing
View Details orb2658950-02 100 µg
Recombinant Caenorhabditis elegans SAM domain-containing protein (bcc-1), partial
Sign In for Pricing
View Details orb2658950-03 1 mg
Recombinant Caenorhabditis elegans SAM domain-containing protein (bcc-1), partial
Sign In for Pricing
View Details 
