Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHPN2 Peptide - N-terminal region

RHPN2 Peptide - N-terminal region

Product Specifications

UniProt

Q8IUC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHPN2 Rabbit Polyclonal Antibody (orb589085) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149094.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALLPAAPQPLEKENDGYFRKGCNPLAQTGRSKLQNQRAALNQQILKAVRM

More Discoveries

Explore Other Products

Browse additional items from our catalog

LK-ELEC Lockout Tagout Kits
196217 1 Kit (1 Kit x 1 Kit)

LK-ELEC Lockout Tagout Kits

Sign In for Pricing
View Details
IFNA2 (Interferon, alpha 2, IFNA, INFA2, MGC125764, MGC125765) (APC)
247445-APC 100 µL

IFNA2 (Interferon, alpha 2, IFNA, INFA2, MGC125764, MGC125765) (APC)

Sign In for Pricing
View Details
NCS-382, Sodium Salt
TRC-N385000-250MG 250 mg

NCS-382, Sodium Salt

Sign In for Pricing
View Details
Anti - Human IgG
MBS684243-01 1 mL (RTU)

Anti - Human IgG

Sign In for Pricing
View Details
Anti - Human IgG
MBS684243-02 0.04 mL

Anti - Human IgG

Sign In for Pricing
View Details
Anti - Human IgG
MBS684243-03 0.1 mL

Anti - Human IgG

Sign In for Pricing
View Details