RHPN2 Peptide - N-terminal region
RHPN2 Peptide - N-terminal region
Product Specifications
UniProt
Q8IUC4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RHPN2 Rabbit Polyclonal Antibody (orb589085) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_149094.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ALLPAAPQPLEKENDGYFRKGCNPLAQTGRSKLQNQRAALNQQILKAVRM
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC229561L3V 200 µL
RNF166 (NM_001171816) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
MBS9348192-03 5x 96 Well
Porcine Vitamin D3 Receptor (VDR) ELISA Kit
Sign In for Pricing
View Details MBS9348192-04 10x 96 Well
Porcine Vitamin D3 Receptor (VDR) ELISA Kit
Sign In for Pricing
View Details ![Rabbit Polyclonal DLGAP3 Antibody [Alexa Fluor 594]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP2-81713AF594 0.1 mL
Rabbit Polyclonal DLGAP3 Antibody [Alexa Fluor 594]
Sign In for Pricing
View Details