Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH2D3A Peptide - N-terminal region

SH2D3A Peptide - N-terminal region

Product Specifications

UniProt

Q9BRG2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH2D3A Rabbit Polyclonal Antibody (orb589114) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005481.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QVPQDGEDLAGQPWYHGLLSRQKAEALLQQNGDFLVRASGSRGGNPVISC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SQSTM1/p62 Recombinant Rabbit mAb, BF350 conjugated
orb2333066 100 µL

SQSTM1/p62 Recombinant Rabbit mAb, BF350 conjugated

Sign In for Pricing
View Details
YajQ Antibody
orb831668 2 mg

YajQ Antibody

Sign In for Pricing
View Details
Mouse anti-PI3K p110 alpha Antibody
MBS4514123-01 0.05 mL

Mouse anti-PI3K p110 alpha Antibody

Sign In for Pricing
View Details
Mouse anti-PI3K p110 alpha Antibody
MBS4514123-02 0.1 mL

Mouse anti-PI3K p110 alpha Antibody

Sign In for Pricing
View Details
Mouse anti-PI3K p110 alpha Antibody
MBS4514123-03 5x 0.1 mL

Mouse anti-PI3K p110 alpha Antibody

Sign In for Pricing
View Details
Lentiviral mouse Bves shRNA (UAS) - Lentiviral mouse Bves shRNA (UAS, RFP) plasmid
GTR15265225 1 Vial

Lentiviral mouse Bves shRNA (UAS) - Lentiviral mouse Bves shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details