SH2D3A Peptide - N-terminal region
SH2D3A Peptide - N-terminal region
Product Specifications
UniProt
Q9BRG2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SH2D3A Rabbit Polyclonal Antibody (orb589114) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005481.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QVPQDGEDLAGQPWYHGLLSRQKAEALLQQNGDFLVRASGSRGGNPVISC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
042659-ML650 100 µL
TBL2, NT (TBL2, WBSCR13, Transducin beta-like protein 2, WS beta-transducin repeats protein, Williams-Beuren syndrome chromosomal region 13 protein) (MaxLight 650) discontinued
Sign In for Pricing
View Details MBS6386226-01 0.1 mL
MYBPH (Myosin-binding Protein H, H-Protein) (AP)
Sign In for Pricing
View Details MBS6386226-02 5x 0.1 mL
MYBPH (Myosin-binding Protein H, H-Protein) (AP)
Sign In for Pricing
View Details