Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC3R Peptide - C-terminal region

MC3R Peptide - C-terminal region

Product Specifications

Product Name Alternative

MC3, OB20, OQTL, BMIQ9, MC3-R

UniProt

P41968

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MC3R Rabbit Polyclonal Antibody (orb589171) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_063941.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H4 Rabbit mAb
C05352-20ul 20 µL

Histone H4 Rabbit mAb

Sign In for Pricing
View Details
Urea crystalline p.A.
LC-9827.1 5 Kg

Urea crystalline p.A.

Sign In for Pricing
View Details
Cytochalasin H 100mg
A16088-100 100 mg

Cytochalasin H 100mg

Sign In for Pricing
View Details
Heme Oxygenase 1 (HMOX1) Human Over-expression Lysate
orb1378727 20 µg

Heme Oxygenase 1 (HMOX1) Human Over-expression Lysate

Sign In for Pricing
View Details
Human RIDA Protein Lysate
MBS8418598-01 0.02 mg

Human RIDA Protein Lysate

Sign In for Pricing
View Details
Human RIDA Protein Lysate
MBS8418598-02 5x 0.02 mg

Human RIDA Protein Lysate

Sign In for Pricing
View Details