Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP2A2 Peptide - N-terminal region

ATP2A2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DD, DAR, ATP2B, SERCA2

UniProt

P16615

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP2A2 Rabbit Polyclonal Antibody (orb588217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001672.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prox1 Rabbit Polyclonal Antibody (AP)
orb902548 100 µL

Prox1 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
DAO Antibody
MBS9403776-01 0.05 mL

DAO Antibody

Sign In for Pricing
View Details
DAO Antibody
MBS9403776-02 0.1 mL

DAO Antibody

Sign In for Pricing
View Details
DAO Antibody
MBS9403776-03 5x 0.1 mL

DAO Antibody

Sign In for Pricing
View Details
TNP2 (Transition Protein 2, TP2, During Histone To Protamine Replacement, Nuclear transition protein 2)
365385 200 µL

TNP2 (Transition Protein 2, TP2, During Histone To Protamine Replacement, Nuclear transition protein 2)

Sign In for Pricing
View Details
2-Amino-4-chloro-6-nitrobenzoic acid
OR1049908-01 100 mg

2-Amino-4-chloro-6-nitrobenzoic acid

Sign In for Pricing
View Details