Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP2A2 Peptide - N-terminal region

ATP2A2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DD, DAR, ATP2B, SERCA2

UniProt

P16615

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP2A2 Rabbit Polyclonal Antibody (orb588217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001672.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDCL AAV Vector (Human) (CMV)
36268101 1 µg

PDCL AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Arid3c ORF Vector (Mouse) (pORF)
ORF039018 1.0 µg DNA

Arid3c ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ITGAD (16Y18) Mouse Monoclonal antibody
E28PE2596 100 µL

ITGAD (16Y18) Mouse Monoclonal antibody

Sign In for Pricing
View Details
MMRN1 Rabbit Polyclonal Antibody (Biotin)
orb445448 100 µL

MMRN1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
XRCC3 (X-ray Repair Cross-complementing Protein 3, CMM6) discontinued
214193-01 20 µL

XRCC3 (X-ray Repair Cross-complementing Protein 3, CMM6) discontinued

Sign In for Pricing
View Details
XRCC3 (X-ray Repair Cross-complementing Protein 3, CMM6) discontinued
214193-02 100 µL

XRCC3 (X-ray Repair Cross-complementing Protein 3, CMM6) discontinued

Sign In for Pricing
View Details