PSMB7 Peptide - middle region
PSMB7 Peptide - middle region
Product Specifications
Product Name Alternative
Z
UniProt
Q99436
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PSMB7 Rabbit Polyclonal Antibody (orb589256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002790.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP2-89359AF594 0.1 mL
Rabbit Monoclonal Carboxypeptidase M Antibody (105) [Alexa Fluor 594]
Sign In for Pricing
View Details 
GTR15227358 1 Vial
Lentiviral mouse Hacd2 shRNA (UAS) - Lentiviral mouse Hacd2 shRNA (UAS) (100)
Sign In for Pricing
View Details orb2899100-01 1 mg
Human IgG1 (L234A/L235A/G237A) -kappa Isotype control Antibody
Sign In for Pricing
View Details