Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMB7 Peptide - middle region

PSMB7 Peptide - middle region

Product Specifications

Product Name Alternative

Z

UniProt

Q99436

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMB7 Rabbit Polyclonal Antibody (orb589256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002790.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAAR2 3'UTR Lenti-reporter-Luc Vector
46022081 1.0 µg

TAAR2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
FAM71F2 Antibody
orb1555608-01 50 μL

FAM71F2 Antibody

Sign In for Pricing
View Details
FAM71F2 Antibody
orb1555608-02 100 µL

FAM71F2 Antibody

Sign In for Pricing
View Details
FAM71F2 Antibody
orb1555608-03 200 µL

FAM71F2 Antibody

Sign In for Pricing
View Details
Cavy Sororin (CDCA5) ELISA Kit
MBS9920997 Inquire

Cavy Sororin (CDCA5) ELISA Kit

Sign In for Pricing
View Details
Ipo7 sgRNA CRISPR Lentivector set (Mouse)
K4600801 3x 1.0 µg

Ipo7 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details