PAN3 Peptide - middle region
PAN3 Peptide - middle region
Product Specifications
UniProt
Q58A45
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PAN3 Rabbit Polyclonal Antibody (orb589276) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_787050.6
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LHSPKITPHTSPAPRRRSHTPNPASYMVPSSASTSVNNPVSQTPSSGQVI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6460252-01 0.1 mL
WNT8a (Protein Wnt-8a, wnt8a, wnt-8, wnt8) (MaxLight 750)
Sign In for Pricing
View Details MBS6460252-02 5x 0.1 mL
WNT8a (Protein Wnt-8a, wnt8a, wnt-8, wnt8) (MaxLight 750)
Sign In for Pricing
View Details