TDRKH Peptide - middle region
TDRKH Peptide - middle region
Product Specifications
Product Name Alternative
TDRD2
UniProt
Q9Y2W6
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TDRKH Rabbit Polyclonal Antibody (orb589137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001077432.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SKEGSWEKPSDDSFQKSEAQAIPEMPMFEIPSPDFSFHADEYLEVYVSAS
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7022987-01 0.02 mg
Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit 3 (ndhC)
Sign In for Pricing
View Details MBS7022987-02 0.1 mg
Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit 3 (ndhC)
Sign In for Pricing
View Details MBS7022987-03 5x 0.1 mg
Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit 3 (ndhC)
Sign In for Pricing
View Details NNA74912-01 50 mg
3,3-Dimethyl-2- (1-oxo-2,3-dihydro-1H-isoindol-2-yl) butanoic acid
Sign In for Pricing
View Details