TDRKH Peptide - middle region
TDRKH Peptide - middle region
Product Specifications
Product Name Alternative
TDRD2
UniProt
Q9Y2W6
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TDRKH Rabbit Polyclonal Antibody (orb589137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001077432.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SKEGSWEKPSDDSFQKSEAQAIPEMPMFEIPSPDFSFHADEYLEVYVSAS
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9437150-01 0.1 mL (Biotin)
HDAC4/HDAC5/HDAC9 (Phospho-Ser246/259/220) Polyclonal Conjugated Antibody
Sign In for Pricing
View Details MBS9437150-02 0.1 mL (AF350)
HDAC4/HDAC5/HDAC9 (Phospho-Ser246/259/220) Polyclonal Conjugated Antibody
Sign In for Pricing
View Details MBS9437150-03 0.1 mL (AF405)
HDAC4/HDAC5/HDAC9 (Phospho-Ser246/259/220) Polyclonal Conjugated Antibody
Sign In for Pricing
View Details