Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDRKH Peptide - middle region

TDRKH Peptide - middle region

Product Specifications

Product Name Alternative

TDRD2

UniProt

Q9Y2W6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TDRKH Rabbit Polyclonal Antibody (orb589137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001077432.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKEGSWEKPSDDSFQKSEAQAIPEMPMFEIPSPDFSFHADEYLEVYVSAS

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tex35 (NM_028540) Mouse Tagged ORF Clone
MG214667 10 µg

Tex35 (NM_028540) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CORO2A Recombinant Protein (Rat)
RP195974 100 µg

CORO2A Recombinant Protein (Rat)

Sign In for Pricing
View Details
Recombinant Anti-Thioredoxin/TRX Antibody, Rabbit Monoclonal
MBS8102581-01 0.1 mL

Recombinant Anti-Thioredoxin/TRX Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details
Recombinant Anti-Thioredoxin/TRX Antibody, Rabbit Monoclonal
MBS8102581-02 5x 0.1 mL

Recombinant Anti-Thioredoxin/TRX Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details
Mouse Anti-TUBE1 Recombinant Antibody (EC141)
V2LY-0613-LY141 Each

Mouse Anti-TUBE1 Recombinant Antibody (EC141)

Sign In for Pricing
View Details
EMILIN-5 (F-11) Alexa Fluor® 546
sc-390777 AF546 200 µg/mL

EMILIN-5 (F-11) Alexa Fluor® 546

Sign In for Pricing
View Details