GLCE Peptide - middle region
GLCE Peptide - middle region
Product Specifications
Product Name Alternative
HSEPI
UniProt
O94923
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GLCE Rabbit Polyclonal Antibody (orb589345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_056369.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TKDHIFLNSALRATAPYKFLSEQHGVKAVFMNKHDWYEEYPTTPSSFVLN
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6157602 1.0 µg DNA
Caps2 sgRNA CRISPR Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details 
201-12-3847 96 Tests
Human Gamma-Glutamyltransferase 3 (gGT3) ELISA Kit
Sign In for Pricing
View Details 