GLCE Peptide - middle region
GLCE Peptide - middle region
Product Specifications
Product Name Alternative
HSEPI
UniProt
O94923
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GLCE Rabbit Polyclonal Antibody (orb589345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_056369.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TKDHIFLNSALRATAPYKFLSEQHGVKAVFMNKHDWYEEYPTTPSSFVLN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1030118-01 0.02 mg (E-Coli)
Recombinant Human Phospholipase D2 (PLD2) , partial
Sign In for Pricing
View Details MBS1030118-02 0.02 mg (Yeast)
Recombinant Human Phospholipase D2 (PLD2) , partial
Sign In for Pricing
View Details MBS1030118-03 0.1 mg (E-Coli)
Recombinant Human Phospholipase D2 (PLD2) , partial
Sign In for Pricing
View Details MBS1030118-04 0.1 mg (Yeast)
Recombinant Human Phospholipase D2 (PLD2) , partial
Sign In for Pricing
View Details MBS1030118-05 0.02 mg (Baculovirus)
Recombinant Human Phospholipase D2 (PLD2) , partial
Sign In for Pricing
View Details MBS1030118-06 0.02 mg (Mammalian-Cell)
Recombinant Human Phospholipase D2 (PLD2) , partial
Sign In for Pricing
View Details