Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCR2 Peptide - C-terminal region

NCR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LY95, CD336, NKP44, NK-p44, dJ149M18.1

UniProt

O95944

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCR2 Rabbit Polyclonal Antibody (orb585801) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004819

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVAKSLVLSALLVWWGDIWWKTMMELRSLDTQKATCHLQQVTDLPWTSVS

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR2 Mouse Monoclonal Antibody [Clone 5C5]
E45M11466V-2 50 µL

FGFR2 Mouse Monoclonal Antibody [Clone 5C5]

Sign In for Pricing
View Details
Micromer®-M streptavidin
08-19-403 1 mL

Micromer®-M streptavidin

Sign In for Pricing
View Details
Recombinant Human IL1RL1/ST2 Protein, C-His
orb3061326-01 50 µg

Recombinant Human IL1RL1/ST2 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human IL1RL1/ST2 Protein, C-His
orb3061326-02 100 µg

Recombinant Human IL1RL1/ST2 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human IL1RL1/ST2 Protein, C-His
orb3061326-03 1 mg

Recombinant Human IL1RL1/ST2 Protein, C-His

Sign In for Pricing
View Details
Pig Pregnancy Associated glycoprotein 4 (PAG4) ELISA Kit
orb782451-01 48 Tests

Pig Pregnancy Associated glycoprotein 4 (PAG4) ELISA Kit

Sign In for Pricing
View Details