NCR2 Peptide - C-terminal region
NCR2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
LY95, CD336, NKP44, NK-p44, dJ149M18.1
UniProt
O95944
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NCR2 Rabbit Polyclonal Antibody (orb585801) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_004819
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LVAKSLVLSALLVWWGDIWWKTMMELRSLDTQKATCHLQQVTDLPWTSVS
More Discoveries
Explore Other Products
Browse additional items from our catalog
bsm-61077R-PE-Cy7-01 20 µL
TOP2A Recombinant Antibody, PE-Cy7 Conjugated
Sign In for Pricing
View Details bsm-61077R-PE-Cy7-02 100 µL
TOP2A Recombinant Antibody, PE-Cy7 Conjugated
Sign In for Pricing
View Details 
126098-HRP 100 µL
DYRK1B (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1B, Minibrain-related Kinase, Mirk Protein Kinase, MIRK) (HRP)
Sign In for Pricing
View Details