Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLASP1 Peptide - middle region

CLASP1 Peptide - middle region

Product Specifications

Product Name Alternative

MAST1

UniProt

C9J151

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLASP1 Rabbit Polyclonal Antibody (orb589298) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001135745.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VIFTKFDEVQKSGNMIQSANDKNFDDEDSVDGNRPSSASSTSSKAPPSSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PT7-EGFP-PLIN5-6xHis Plasmid
PVT76850 2 µg

PT7-EGFP-PLIN5-6xHis Plasmid

Sign In for Pricing
View Details
Sphingolipid delta (DEGS1) Human ELISA Kit
H2755 96 Tests

Sphingolipid delta (DEGS1) Human ELISA Kit

Sign In for Pricing
View Details
GRID1 Antibody
DF3599-01 100 µL

GRID1 Antibody

Sign In for Pricing
View Details
GRID1 Antibody
DF3599-02 200 µL

GRID1 Antibody

Sign In for Pricing
View Details
Mouse Ndufa9 Pre-designed siRNA Set B
SI109185B 1 Each

Mouse Ndufa9 Pre-designed siRNA Set B

Sign In for Pricing
View Details
C3CER1 Protein Vector (Human) (pPB-N-His)
PV066562 500 ng

C3CER1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details