Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLASP1 Peptide - middle region

CLASP1 Peptide - middle region

Product Specifications

Product Name Alternative

MAST1

UniProt

C9J151

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLASP1 Rabbit Polyclonal Antibody (orb589298) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001135745.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VIFTKFDEVQKSGNMIQSANDKNFDDEDSVDGNRPSSASSTSSKAPPSSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsp90-Cdc37-IN-3
BA3197-5 5 mg

Hsp90-Cdc37-IN-3

Sign In for Pricing
View Details
gAcrp30/Adipolean, Human
HY-P7357 10 µg

gAcrp30/Adipolean, Human

Sign In for Pricing
View Details
Phospho-c-Fos (Ser362) Rabbit Polyclonal Antibody (BF594)
orb2529703 100 µL

Phospho-c-Fos (Ser362) Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Horse tri-iodothyronine ELISA Kit
orb340080-01 24 Tests

Horse tri-iodothyronine ELISA Kit

Sign In for Pricing
View Details
Horse tri-iodothyronine ELISA Kit
orb340080-02 48 Tests

Horse tri-iodothyronine ELISA Kit

Sign In for Pricing
View Details
Horse tri-iodothyronine ELISA Kit
orb340080-03 96 Tests

Horse tri-iodothyronine ELISA Kit

Sign In for Pricing
View Details