Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP3M1 Peptide - C-terminal region

AP3M1 Peptide - C-terminal region

Product Specifications

UniProt

Q9Y2T2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AP3M1 Rabbit Polyclonal Antibody (orb589324) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_036227.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQGSYTFDPVTKVLTWDVGKITPQKLPSLKGLVNLQSGAPKPEENPSLNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB10 (NM_001105539) Human Over-expression Lysate
LS065986 100 µg

ZBTB10 (NM_001105539) Human Over-expression Lysate

Sign In for Pricing
View Details
Octahydro-1'H-spiro[1,3-dioxolane-2,6'-quinoline]
LKC27094-01 50 mg

Octahydro-1'H-spiro[1,3-dioxolane-2,6'-quinoline]

Sign In for Pricing
View Details
Octahydro-1'H-spiro[1,3-dioxolane-2,6'-quinoline]
LKC27094-02 0.5 g

Octahydro-1'H-spiro[1,3-dioxolane-2,6'-quinoline]

Sign In for Pricing
View Details
C20orf194 Antibody - N-terminal region : HRP (ARP32541_P050-HRP)
ARP32541_P050-HRP 100 µL

C20orf194 Antibody - N-terminal region : HRP (ARP32541_P050-HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal PACS2 Antibody [CoraFluor 1]
NBP2-81975CL1 0.1 mL

Rabbit Polyclonal PACS2 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
SKIV2L2 Rabbit pAb
E45R25927N-50 50 µL

SKIV2L2 Rabbit pAb

Sign In for Pricing
View Details