Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP3M1 Peptide - C-terminal region

AP3M1 Peptide - C-terminal region

Product Specifications

UniProt

Q9Y2T2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AP3M1 Rabbit Polyclonal Antibody (orb589324) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_036227.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQGSYTFDPVTKVLTWDVGKITPQKLPSLKGLVNLQSGAPKPEENPSLNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human VAV3 knockdown cell line
ABC-KD16720 1 Vial

Human VAV3 knockdown cell line

Sign In for Pricing
View Details
4-Methylsulphonylaniline
FM36441-01 1 Kg

4-Methylsulphonylaniline

Sign In for Pricing
View Details
4-Methylsulphonylaniline
FM36441-02 2 Kg

4-Methylsulphonylaniline

Sign In for Pricing
View Details
Rat Forkhead box O3A, FOXO3A ELISA Kit
MBS9305817-01 48 Well

Rat Forkhead box O3A, FOXO3A ELISA Kit

Sign In for Pricing
View Details
Rat Forkhead box O3A, FOXO3A ELISA Kit
MBS9305817-02 96 Well

Rat Forkhead box O3A, FOXO3A ELISA Kit

Sign In for Pricing
View Details
Rat Forkhead box O3A, FOXO3A ELISA Kit
MBS9305817-03 5x 96 Well

Rat Forkhead box O3A, FOXO3A ELISA Kit

Sign In for Pricing
View Details