Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Il1f5 Peptide - C-terminal region

Il1f5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Il1f5

UniProt

D4A1A6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Il1f5 Rabbit Polyclonal Antibody (orb582827) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101284

Preservative

Lyophilized powder

AA Sequence

LGTKESKSFTFYRRDLGLTSSFESAAYPGWFLCTSPEADQPVRLTQISED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC3 Human Gene Knockout Kit (CRISPR)
KN200605RB 1 Kit

HDAC3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rabbit Polyclonal Gastric Lipase Antibody [DyLight 405]
NBP2-97330V 0.1 mL

Rabbit Polyclonal Gastric Lipase Antibody [DyLight 405]

Sign In for Pricing
View Details
CASC4 Protein Vector (Human) (pPM-C-His)
PV007536 500 ng

CASC4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
USP2 (NM_171997) Human Recombinant Protein
PH35371M5 20 µg

USP2 (NM_171997) Human Recombinant Protein

Sign In for Pricing
View Details
PTPRC Antibody
OAGA05277-100UL 100 µL

PTPRC Antibody

Sign In for Pricing
View Details
RAB33B Rabbit pAb
A18506 100 µL

RAB33B Rabbit pAb

Sign In for Pricing
View Details