Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL2 Peptide - middle region

KLHL2 Peptide - middle region

Product Specifications

Product Name Alternative

ABP-KELCH, MAV, MAYVEN

UniProt

Q8JZP3

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLHL2 Rabbit Polyclonal Antibody (orb581661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009177

Preservative

Lyophilized powder

AA Sequence

TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD137 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-2449R-BF594-TR 20 µL

CD137 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
53BP1 Polyclonal Antibody
RA21503-01 50 µL

53BP1 Polyclonal Antibody

Sign In for Pricing
View Details
53BP1 Polyclonal Antibody
RA21503-02 100 µL

53BP1 Polyclonal Antibody

Sign In for Pricing
View Details
Truenat™ CT
601140020 20T

Truenat™ CT

Sign In for Pricing
View Details
Human NKG2D ligand 2 ELISA Kit
EK4447 Inquire

Human NKG2D ligand 2 ELISA Kit

Sign In for Pricing
View Details
BMP6, 375-513aa, Human, His tag, E Coli
MBS204953-01 0.01 mg

BMP6, 375-513aa, Human, His tag, E Coli

Sign In for Pricing
View Details