Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL2 Peptide - middle region

KLHL2 Peptide - middle region

Product Specifications

Product Name Alternative

ABP-KELCH, MAV, MAYVEN

UniProt

Q8JZP3

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLHL2 Rabbit Polyclonal Antibody (orb581661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009177

Preservative

Lyophilized powder

AA Sequence

TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP3/4 Antibody
E38PA3492 100 µL

SP3/4 Antibody

Sign In for Pricing
View Details
Mianserin Impurity 45
RM-M092445-01 10 mg

Mianserin Impurity 45

Sign In for Pricing
View Details
Mianserin Impurity 45
RM-M092445-02 25 mg

Mianserin Impurity 45

Sign In for Pricing
View Details
Mianserin Impurity 45
RM-M092445-03 50 mg

Mianserin Impurity 45

Sign In for Pricing
View Details
Mianserin Impurity 45
RM-M092445-04 100 mg

Mianserin Impurity 45

Sign In for Pricing
View Details
Mouse IgG (High Specificity) ELISA
KT-635 96 Tests

Mouse IgG (High Specificity) ELISA

Sign In for Pricing
View Details