Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NARF Peptide - middle region

NARF Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp434G0420, FLJ10067, IOP2

UniProt

B3KPX2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NARF Rabbit Polyclonal Antibody (orb582353) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001033707

Preservative

Lyophilized powder

AA Sequence

RGQAQTPDGHADKALLRQMEGIYADIPVRRPESSAHVQELYQEWLEGINS

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDCCAG10 antibody
MBS838872-01 0.05 mL

SDCCAG10 antibody

Sign In for Pricing
View Details
SDCCAG10 antibody
MBS838872-02 5x 0.05 mL

SDCCAG10 antibody

Sign In for Pricing
View Details
Simian LTF (Lactoferrin) ELISA Kit
orb3126896-01 48 Tests

Simian LTF (Lactoferrin) ELISA Kit

Sign In for Pricing
View Details
Simian LTF (Lactoferrin) ELISA Kit
orb3126896-02 96 Tests

Simian LTF (Lactoferrin) ELISA Kit

Sign In for Pricing
View Details
STK32A Protein Vector (Rat) (pPB-N-His)
PV308627 500 ng

STK32A Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 7 (ENPP7) Antibody
abx242472-01 50 µL

Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 7 (ENPP7) Antibody

Sign In for Pricing
View Details