NARF Peptide - middle region
NARF Peptide - middle region
Product Specifications
Product Name Alternative
DKFZp434G0420, FLJ10067, IOP2
UniProt
B3KPX2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NARF Rabbit Polyclonal Antibody (orb582353) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001033707
Preservative
Lyophilized powder
AA Sequence
RGQAQTPDGHADKALLRQMEGIYADIPVRRPESSAHVQELYQEWLEGINS
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7222874-01 48 Well
Monkey Kelch-like ECH-associated protein 1 (KEAP1) ELISA Kit
Sign In for Pricing
View Details 
MBS7222874-02 96 Well
Monkey Kelch-like ECH-associated protein 1 (KEAP1) ELISA Kit
Sign In for Pricing
View Details 
MBS7222874-03 5x 96 Well
Monkey Kelch-like ECH-associated protein 1 (KEAP1) ELISA Kit
Sign In for Pricing
View Details MBS7222874-04 10x 96 Well
Monkey Kelch-like ECH-associated protein 1 (KEAP1) ELISA Kit
Sign In for Pricing
View Details 