Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT6 Peptide - middle region

NUDT6 Peptide - middle region

Product Specifications

Product Name Alternative

ASFGF2, FGF-2, FGF-AS, FGF2AS, bFGF, gfg, gfg-1, GFG1, GFG-1

UniProt

P53370

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT6 Rabbit Polyclonal Antibody (orb585206) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009014

Preservative

Lyophilized powder

AA Sequence

ASLGFCFHHAESDSSTLTLWLREGPSRLPGYASHQVGVAGAVFDESTRKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UGT2B15 Antibody
MBS8594421-01 0.1 mg

UGT2B15 Antibody

Sign In for Pricing
View Details
UGT2B15 Antibody
MBS8594421-02 0.1 mL (AF405L)

UGT2B15 Antibody

Sign In for Pricing
View Details
UGT2B15 Antibody
MBS8594421-03 0.1 mL (AF405S)

UGT2B15 Antibody

Sign In for Pricing
View Details
UGT2B15 Antibody
MBS8594421-04 0.1 mL (AF610)

UGT2B15 Antibody

Sign In for Pricing
View Details
UGT2B15 Antibody
MBS8594421-05 0.1 mL (AF635)

UGT2B15 Antibody

Sign In for Pricing
View Details
UGT2B15 Antibody
MBS8594421-06 0.1 mL (APC)

UGT2B15 Antibody

Sign In for Pricing
View Details